IFITM1 (NM_003641) Human Recombinant Protein

IFITM1 protein,

Recombinant protein of human interferon induced transmembrane protein 1 (9-27) (IFITM1)

Product Info Summary

SKU: PROTP13164
Size: 20 µg
Source: HEK293T

Product Name

IFITM1 (NM_003641) Human Recombinant Protein

View all IFITM1 recombinant proteins

SKU/Catalog Number

PROTP13164

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human interferon induced transmembrane protein 1 (9-27) (IFITM1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

IFITM1 (NM_003641) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP13164)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.8 kDa

Amino Acid Sequence

MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY

Validation Images & Assay Conditions

Gene/Protein Information For IFITM1 (Source: Uniprot.org, NCBI)

Gene Name

IFITM1

Full Name

Interferon-induced transmembrane protein 1

Weight

13.8 kDa

Superfamily

CD225/Dispanin family

Alternative Names

CD225 antigen; CD225; CD225Leu-13 antigen; IFI17; IFI17LEU13,9-27; IFITM1; interferon induced transmembrane protein 1 (9-27); Interferon-induced protein 17; interferon-induced transmembrane protein 1; Interferon-inducible protein 9-27; Leu-13 IFITM1 9-27, CD225, DSPA2a, IFI17, LEU13 interferon induced transmembrane protein 1 interferon-induced transmembrane protein 1|dispanin subfamily A member 2a|interferon-induced protein 17|interferon-inducible protein 9-27|leu-13

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IFITM1, check out the IFITM1 Infographic

IFITM1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IFITM1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP13164

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used IFITM1 (NM_003641) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For IFITM1 (NM_003641) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for IFITM1 (NM_003641) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP13164
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.