IFI30 (NM_006332) Human Recombinant Protein

GILT/IFI30 protein,

Product Info Summary

SKU: PROTP13284
Size: 20 µg
Source: HEK293T

Product Name

IFI30 (NM_006332) Human Recombinant Protein

View all GILT/IFI30 recombinant proteins

SKU/Catalog Number

PROTP13284

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens interferon, gamma-inducible protein 30 (IFI30)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

IFI30 (NM_006332) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP13284)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.2 kDa

Amino Acid Sequence

MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK

Validation Images & Assay Conditions

Gene/Protein Information For IFI30 (Source: Uniprot.org, NCBI)

Gene Name

IFI30

Full Name

Gamma-interferon-inducible lysosomal thiol reductase

Weight

25.2 kDa

Superfamily

GILT family

Alternative Names

EC 1.8; Gamma-interferon-inducible protein IP-30; GILT; GILTgamma-interferon-inducible lysosomal thiol reductase; IFI30; IFI-30; interferon, gamma-inducible protein 30; IP30; IP30interferon gamma-inducible protein 30 preproprotein; Legumaturain; MGC32056 IFI30 GILT, IFI-30, IP-30, IP30 IFI30 lysosomal thiol reductase gamma-interferon-inducible lysosomal thiol reductase|gamma-interferon-inducible protein IP-30|interferon gamma-inducible protein 30 preproprotein|interferon, gamma-inducible protein 30|legumaturain

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IFI30, check out the IFI30 Infographic

IFI30 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IFI30: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP13284

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used IFI30 (NM_006332) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For IFI30 (NM_006332) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for IFI30 (NM_006332) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP13284
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.