ICAD (DFFA) (NM_004401) Human Recombinant Protein

DFF45/ICAD protein,

Product Info Summary

SKU: PROTO00273
Size: 20 µg
Source: HEK293T

Product Name

ICAD (DFFA) (NM_004401) Human Recombinant Protein

View all DFF45/ICAD recombinant proteins

SKU/Catalog Number

PROTO00273

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ICAD (DFFA) (NM_004401) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO00273)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.3 kDa

Amino Acid Sequence

MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT

Validation Images & Assay Conditions

Gene/Protein Information For DFFA (Source: Uniprot.org, NCBI)

Gene Name

DFFA

Full Name

DNA fragmentation factor subunit alpha

Weight

36.3 kDa

Alternative Names

DFF1; DFF1DNA fragmentation factor 45 kDa subunit; DFF45; DFF45DNA fragmentation factor subunit alpha; DFF-45DNA fragmentation factor, 45 kD, alpha polypeptide; DFFA; DNA fragmentation factor, 45kDa, alpha polypeptide; ICAD; Inhibitor of CAD DFFA DFF-45, DFF1, ICAD DNA fragmentation factor subunit alpha DNA fragmentation factor subunit alpha|DFF45|DNA fragmentation factor 45 kDa subunit|DNA fragmentation factor, 45kDa, alpha polypeptide|inhibitor of CAD

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DFFA, check out the DFFA Infographic

DFFA infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DFFA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO00273

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ICAD (DFFA) (NM_004401) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ICAD (DFFA) (NM_004401) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ICAD (DFFA) (NM_004401) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO00273
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product