Click image to see more details
Product Info Summary
| SKU: | PROTP01374-6 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant TNF beta (Tumor necrosis factor beta) protein, AF
View all LTA recombinant proteins
SKU/Catalog Number
PROTP01374-6
Size
5ug,20ug,100ug
Tag
His Tag (N-term)
Description
Human TNF beta (Lymphotoxin-alpha) is a 22 kDa cytokine with 205 amino acid residues. TNF beta belongs to tumor necrosis factor (TNF) superfamily as TNF alpha. Binding to lymphotoxin-β receptor (LtβR), canonical and non-canonical NF-κB signal pathway will be activated. TNF beta is related to apoptosis and inflammatory signals
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant TNF beta (Tumor necrosis factor beta) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01374-6)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
22.297kDa
Molecular weight
The protein has a calculated MW of 18.65 kDa. The protein migrates as 21 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce cytotoxicity in L929 cells in the presence of actinomycin D. The ED₅₀ for this effect is <3 pg/mL. The specific activity of recombinant human TNF beta is > 3.3x 10⁸ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human TNF beta
Protein Target Info & Infographic
Gene/Protein Information For LTA (Source: Uniprot.org, NCBI)
Gene Name
LTA
Full Name
Lymphotoxin-alpha
Weight
22.297kDa
Superfamily
tumor necrosis factor family
Alternative Names
TNFSF1B, Lymphotoxin-alpha (LT-α),LTA LTA LT, TNFB, TNFSF1, TNLG1E lymphotoxin alpha lymphotoxin-alpha|LT-alpha|TNF superfamily, member 1|TNF-beta|truncated lymphotoxin alpha|tumor necrosis factor beta|tumor necrosis factor ligand 1E|tumor necrosis factor ligand superfamily member 1
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on LTA, check out the LTA Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for LTA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant TNF beta (Tumor necrosis factor beta) protein, AF (PROTP01374-6)
Hello CJ!
No publications found for PROTP01374-6
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant TNF beta (Tumor necrosis factor beta) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant TNF beta (Tumor necrosis factor beta) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
