Click image to see more details
Product Info Summary
| SKU: | PROTQ15109-2 |
|---|---|
| Size: | 5ug,20ug,100ug,500ug,1mg |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant RAGE (Receptor for advanced glycation endproducts) protein, AF
View all AGER recombinant proteins
SKU/Catalog Number
PROTQ15109-2
Size
5ug,20ug,100ug,500ug,1mg
Tag
His Tag (C-term)
Description
Receptor for advanced glycation endproducts (RAGE) is a 35 kDa transmembrane receptor of the immunoglobulin super family. The mature RAGE has three main parts, consisting of extracellular, transmembrane, and cytosolic regions. A central mechanism by which ligand-RAGE interaction mediates cell stress and upregulates inflammatory pathways is via activation of signal transduction pathways.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant RAGE (Receptor for advanced glycation endproducts) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ15109-2)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
42.803kDa
Molecular weight
The protein has a calculated MW of 30.94 kDa. The protein migrates as 40 kDa under reducing condition (SDS-PAGE analysis).
Activity
Testing in process
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human RAGE
Protein Target Info & Infographic
Gene/Protein Information For AGER (Source: Uniprot.org, NCBI)
Gene Name
AGER
Full Name
Advanced glycosylation end product-specific receptor
Weight
42.803kDa
Alternative Names
advanced glycosylation end-product specific receptor, AGER, SCARJ1 AGER RAGE, SCARJ1, sRAGE advanced glycosylation end-product specific receptor advanced glycosylation end product-specific receptor|receptor for advanced glycation end-products variant 20
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on AGER, check out the AGER Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for AGER: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant RAGE (Receptor for advanced glycation endproducts) protein, AF (PROTQ15109-2)
Hello CJ!
No publications found for PROTQ15109-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant RAGE (Receptor for advanced glycation endproducts) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant RAGE (Receptor for advanced glycation endproducts) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
