No images for this product yet
Product Info Summary
| SKU: | PROTP09603-8 |
|---|---|
| Size: | 5ug,20ug,100ug,500ug,1mg |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant M-CSF (Macrophage colony stimulating factor) protein, AF
View all M-CSF recombinant proteins
SKU/Catalog Number
PROTP09603-8
Size
5ug,20ug,100ug,500ug,1mg
Tag
His Tag (C-term)
Description
Macrophage Colony Stimulating Factor (M-CSF) is a 18.54 kDa member of hematopoietic Growth Factors with 159 amino acid residues. M-CSF produced by osteoblasts and osteoblast precursors. M-CSF stimulates the growth and differentiation of the monocyte lineage, and promotes the survival, proliferation, and functions of mature monocytes/macrophages.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant M-CSF (Macrophage colony stimulating factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP09603-8)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
60.179kDa
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS with polyhistidine tag at the C-terminus.
Assay dilution & Images
Validation Images & Assay Conditions
There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.
Protein Target Info & Infographic
Gene/Protein Information For CSF1 (Source: Uniprot.org, NCBI)
Gene Name
CSF1
Full Name
Macrophage colony-stimulating factor 1
Weight
60.179kDa
Alternative Names
colony stimulating factor 1 (macrophage); CSF1; CSF-1; Lanimostim; macrophage colony stimulating factor; macrophage colony-stimulating factor 1; MCSF; M-CSF; MCSFlanimostim; MGC31930 CSF1 CSF-1, MCSF colony stimulating factor 1 macrophage colony-stimulating factor 1|colony stimulating factor 1 (macrophage)|lanimostim|macrophage colony stimulating factor 1
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on CSF1, check out the CSF1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CSF1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant M-CSF (Macrophage colony stimulating factor) protein, AF (PROTP09603-8)
Hello CJ!
No publications found for PROTP09603-8
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant M-CSF (Macrophage colony stimulating factor) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant M-CSF (Macrophage colony stimulating factor) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
