Human recombinant M-CSF (Macrophage colony stimulating factor) protein, AF

M-CSF protein, Human

Macrophage Colony Stimulating Factor (M-CSF) is a 18.54 kDa member of hematopoietic Growth Factors with 159 amino acid residues. M-CSF produced by osteoblasts and osteoblast precursors. M-CSF stimulates the growth and differentiation of the monocyte lineage, and promotes the survival, proliferation, and functions of mature monocytes/macrophages.

Product Info Summary

SKU: PROTP09603-8
Size: 5ug,20ug,100ug
Origin Species: Human
Source: Escherichia coli
Application: Cell Culture

Product Name

Human recombinant M-CSF (Macrophage colony stimulating factor) protein, AF

View all M-CSF recombinant proteins

SKU/Catalog Number

PROTP09603-8

Size

5ug,20ug,100ug

Tag

His Tag (C-term)

Description

Macrophage Colony Stimulating Factor (M-CSF) is a 18.54 kDa member of hematopoietic Growth Factors with 159 amino acid residues. M-CSF produced by osteoblasts and osteoblast precursors. M-CSF stimulates the growth and differentiation of the monocyte lineage, and promotes the survival, proliferation, and functions of mature monocytes/macrophages.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Human recombinant M-CSF (Macrophage colony stimulating factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP09603-8)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

60.179kDa

Molecular weight

The protein has a calculated MW of 13.34 kDa. The protein migrates as 13-26 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce proliferation in NFS-60 cells. The ED₅₀ for this effect is <1 ng/mL. The specific activity of recombinant human M-CSF is approximately >2.5x 10⁸ IU/mg.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For CSF1 (Source: Uniprot.org, NCBI)

Gene Name

CSF1

Full Name

Macrophage colony-stimulating factor 1

Weight

60.179kDa

Alternative Names

CSF-1, MGI-IM CSF1 CSF-1, MCSF colony stimulating factor 1 macrophage colony-stimulating factor 1|colony stimulating factor 1 (macrophage)|lanimostim|macrophage colony stimulating factor 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CSF1, check out the CSF1 Infographic

CSF1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CSF1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP09603-8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Human recombinant M-CSF (Macrophage colony stimulating factor) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Human recombinant M-CSF (Macrophage colony stimulating factor) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Human recombinant M-CSF (Macrophage colony stimulating factor) protein, AF

Size

Total: $77

SKU:PROTP09603-8

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP09603-8
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.