Human recombinant IL-8 (aa28-99) (Interleukin-8) protein, AF

CXCL8/IL-8 protein, Human

Human IL-8 (aa 28-99) predicts a molecular mass of 8.5 kDa and is the 72 amino acid residue form Ser 28 to Ser 99 of mature human IL-8. This recombinant protein is the major form secreted by macrophages. IL-8 is a chemokine produced by macrophages and other cell types such as epithelial cells, airway smooth muscle cells and endothelial cells.

Product Info Summary

SKU: PROTP10145-7
Size: 5ug,20ug,100ug
Origin Species: Human
Source: Escherichia coli
Application: Cell Culture

Product Name

Human recombinant IL-8 (aa28-99) (Interleukin-8) protein, AF

View all CXCL8/IL-8 recombinant proteins

SKU/Catalog Number

PROTP10145-7

Size

5ug,20ug,100ug

Tag

His Tag (C-term)

Description

Human IL-8 (aa 28-99) predicts a molecular mass of 8.5 kDa and is the 72 amino acid residue form Ser 28 to Ser 99 of mature human IL-8. This recombinant protein is the major form secreted by macrophages. IL-8 is a chemokine produced by macrophages and other cell types such as epithelial cells, airway smooth muscle cells and endothelial cells.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Human recombinant IL-8 (aa28-99) (Interleukin-8) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP10145-7)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

11.098kDa

Molecular weight

The protein has a calculated MW of 9.32 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to chemoattract PBMC. The ED₅₀ for this effect is <2 ng/mL.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For CXCL8 (Source: Uniprot.org, NCBI)

Gene Name

CXCL8

Full Name

Interleukin-8

Weight

11.098kDa

Superfamily

intercrine alpha (chemokine CxC) family

Alternative Names

Monocyte-Derived Neutrophil Chemotactic Factor (MDNCF), Neutrophil Activating Factor (NAF), CXCL8, C-X-C motif chemokine ligand 8 CXCL8 GCP-1, GCP1, IL8, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1, SCYB8 C-X-C motif chemokine ligand 8 interleukin-8|T-cell chemotactic factor|alveolar macrophage chemotactic factor I|beta endothelial cell-derived neutrophil activating peptide|beta-thromboglobulin-like protein|chemokine (C-X-C motif) ligand 8|emoctakin|granulocyte chemotactic protein 1|interleukin 8|lung giant cell carcinoma-derived chemotactic protein|lymphocyte derived neutrophil activating peptide|monocyte-derived neutrophil chemotactic factor|monocyte-derived neutrophil-activating peptide|neutrophil-activating peptide 1|small inducible cytokine subfamily B, member 8|tumor necrosis factor-induced gene 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CXCL8, check out the CXCL8 Infographic

CXCL8 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CXCL8: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used Human recombinant IL-8 (aa28-99) (Interleukin-8) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Human recombinant IL-8 (aa28-99) (Interleukin-8) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Human recombinant IL-8 (aa28-99) (Interleukin-8) protein, AF

Size

Total: $77

SKU:PROTP10145-7

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP10145-7
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.