Human recombinant IL-12 p40 (Interleukin-12 p40) protein, AF

Il12b protein, Human

Interleukin 12 (IL-12) is a pro-inflammatory cytokine with a molecular weight of 70 kDa composed of two subunits, IL-12p35 (35 kDa) and IL-12p40 (40 kDa). IL-12p40 is induced in excess over the other subunits of IL-12 and IL-23 and can exist in a monomeric or homodimer form.

Product Info Summary

SKU: PROTP29460-6
Size: 5ug,20ug,100ug,500ug,1mg
Origin Species: Human
Source: Escherichia coli
Application: Cell Culture

Product Name

Human recombinant IL-12 p40 (Interleukin-12 p40) protein, AF

View all Il12b recombinant proteins

SKU/Catalog Number

PROTP29460-6

Size

5ug,20ug,100ug,500ug,1mg

Tag

His Tag (C-term)

Description

Interleukin 12 (IL-12) is a pro-inflammatory cytokine with a molecular weight of 70 kDa composed of two subunits, IL-12p35 (35 kDa) and IL-12p40 (40 kDa). IL-12p40 is induced in excess over the other subunits of IL-12 and IL-23 and can exist in a monomeric or homodimer form.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Human recombinant IL-12 p40 (Interleukin-12 p40) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP29460-6)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

37.169kDa

Molecular weight

The protein has a calculated MW of 35.64 kDa. The protein migrates as 45 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce cell proliferation in PHA-activated human peripheral blood lymphocytes (PBMC) using a concentration range of 5-50 ng/mL. Note: Results may vary from different PBMC donors.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For IL12B (Source: Uniprot.org, NCBI)

Gene Name

IL12B

Full Name

Interleukin-12 subunit beta

Weight

37.169kDa

Superfamily

IL-12B family

Alternative Names

Interleukin-12 subunit beta, IL-12 subunit p40, IL-12B, Cytotoxic Lymphocyte Maturation Factor 40 kDa subunit (CLMF p40), NK cell Stimulating Factor Chain 2 IL12B CLMF, CLMF2, IL-12B, IMD28, IMD29, NKSF, NKSF2 interleukin 12B interleukin-12 subunit beta|CLMF p40|IL-12 subunit p40|IL12, subunit p40|NK cell stimulatory factor chain 2|cytotoxic lymphocyte maturation factor 40 kDa subunit|interleukin 12, p40|interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40)|interleukin-12 beta chain|natural killer cell stimulatory factor, 40 kD subunit

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IL12B, check out the IL12B Infographic

IL12B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IL12B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP29460-6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Human recombinant IL-12 p40 (Interleukin-12 p40) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Human recombinant IL-12 p40 (Interleukin-12 p40) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Human recombinant IL-12 p40 (Interleukin-12 p40) protein, AF

Size

Total: $77

SKU:PROTP29460-6

Backordered.

Lead time for this item is typically 2-4 weeks

Get A Quote
In stock
Order Product
PROTP29460-6
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.