Click image to see more details
Product Info Summary
| SKU: | PROTO00182-2 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant Galectin-9 protein, AF
View all Galectin-9 recombinant proteins
SKU/Catalog Number
PROTO00182-2
Size
5ug,20ug,100ug
Tag
His Tag (N-term)
Description
Galectin-9 (Gal-9) is a lectin family member and is one of the tandem repeat-type galectins containing two carbohydrate recognition domains (CRD) connected by a linker region in a single peptide chain. The CRD is responsible for β-galactoside binding, and several binding partners for galectin-9 have been identified, including CD44, FGL, Gcgr, GLUT- 2, IgE, IgM, PDI, and Tim-3. Galectin-9 is constitutively presented in the small intestine, liver, uterine epithelial cells, skin epidermis, and esophageal epithelium. Galectin-9 contributing to cell growth, differentiation, adhesion, communication, and death. Accumulated evidence indicates that Gal-9 blockade promotes T cell immunity against tumors, suggesting that galectin-9 is a promising target for immunotherapy.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant Galectin-9 protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO00182-2)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
39.518kDa
Molecular weight
The protein has a calculated MW of 36.7 kDa. The protein migrates as 37 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measured by its ability of the immobilized protein to support the adhesion of Jurkat cells. The ED₅₀ for this effect is <3 μg/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human Galectin-9
Protein Target Info & Infographic
Gene/Protein Information For LGALS9 (Source: Uniprot.org, NCBI)
Gene Name
LGALS9
Full Name
Galectin-9
Weight
39.518kDa
Alternative Names
LGALS9, HUATA, LGALS9 LGALS9 HUATA, LGALS9 galectin 9 galectin-9|ecalectin|gal-9|lectin, galactoside-binding, soluble, 9|tumor HOM-HD-21|urate transporter/channel protein
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on LGALS9, check out the LGALS9 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for LGALS9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant Galectin-9 protein, AF (PROTO00182-2)
Hello CJ!
No publications found for PROTO00182-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant Galectin-9 protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant Galectin-9 protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
