Click image to see more details
Product Info Summary
| SKU: | PROTP49771-7 |
|---|---|
| Size: | 5ug,20ug,100ug,500ug,1mg |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant Flt-3 Ligand (Fms-related tyrosine kinase-3 ligand) protein, AF
View all Flt-3 Ligand/FLT3L recombinant proteins
SKU/Catalog Number
PROTP49771-7
Size
5ug,20ug,100ug,500ug,1mg
Tag
His Tag (C-term)
Description
Fms-related tyrosine kinase-3 ligand (Flt-3 Ligand) is a protein which is encoded by the FLT3LG gene in human. As an important regulator of hematopoiesis, Flt-3 ligand has a tyrosine-protein kinase activity that stimulate the proliferation of hematopoietic progenitor cells of both lymphoid and myeloid origin. Flt-3 ligand can synergistically increase the proliferation of immature progenitors with other cytokines such as GM-CSF, G-CSF, IL-3, EPO, IL-11, IL-12, IL-6 or TPO. Flt-3 ligand is expressed by a variety of hematopoietic progenitor cells including immature hematopoietic and
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant Flt-3 Ligand (Fms-related tyrosine kinase-3 ligand) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP49771-7)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
26.416kDa
Molecular weight
The protein has a calculated MW of 18.6 kDa. The protein migrates as 15-19 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce proliferation in BaF3 cells transfected with mouse Flt-3. The ED₅₀ for this effect is <0.8 ng/mL. The specific activity of recombinant human Flt-3 Ligand is > 1.5 x 10⁶ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human Flt-3 Ligand
Protein Target Info & Infographic
Gene/Protein Information For FLT3LG (Source: Uniprot.org, NCBI)
Gene Name
FLT3LG
Full Name
Fms-related tyrosine kinase 3 ligand
Weight
26.416kDa
Alternative Names
FL, FLG3L, FLT3L FLT3LG FL, FLG3L, FLT3L fms related receptor tyrosine kinase 3 ligand fms-related tyrosine kinase 3 ligand|flt3 ligand|fms related tyrosine kinase 3 ligand
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on FLT3LG, check out the FLT3LG Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for FLT3LG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant Flt-3 Ligand (Fms-related tyrosine kinase-3 ligand) protein, AF (PROTP49771-7)
Hello CJ!
No publications found for PROTP49771-7
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant Flt-3 Ligand (Fms-related tyrosine kinase-3 ligand) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant Flt-3 Ligand (Fms-related tyrosine kinase-3 ligand) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
