Human recombinant FGF-18 (Fibroblast growth factor-18) protein, AF

FGF18 protein, Human

Fibroblast Growth Factors-18 (FGF-18) is a 24 kDa member of the fibroblast Growth Factors with 207 amino acid residues. FGF-18 is mainly expressed from glandular and luminal cells, cardiomyocytes, breast myoepithelial cells and endometrial ciliated cells. FGF-18 involved cell proliferation, cell differentiation and cell migration. FGF-18 is an important role in skeletal growth and development, stimulates hepatic and intestinal proliferation.

Product Info Summary

SKU: PROTO76093-3
Size: 5ug,20ug,100ug
Origin Species: Human
Source: Escherichia coli
Application: Cell Culture

Product Name

Human recombinant FGF-18 (Fibroblast growth factor-18) protein, AF

View all FGF18 recombinant proteins

SKU/Catalog Number

PROTO76093-3

Size

5ug,20ug,100ug

Tag

His Tag (C-term)

Description

Fibroblast Growth Factors-18 (FGF-18) is a 24 kDa member of the fibroblast Growth Factors with 207 amino acid residues. FGF-18 is mainly expressed from glandular and luminal cells, cardiomyocytes, breast myoepithelial cells and endometrial ciliated cells. FGF-18 involved cell proliferation, cell differentiation and cell migration. FGF-18 is an important role in skeletal growth and development, stimulates hepatic and intestinal proliferation.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Human recombinant FGF-18 (Fibroblast growth factor-18) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO76093-3)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

23.989kDa

Molecular weight

The protein has a calculated MW of 21.11 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is 1.3-2.0 ng/mL. The specific activity of recombinant human FGF-18 is > 5 x 10⁵ IU/mg.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For FGF18 (Source: Uniprot.org, NCBI)

Gene Name

FGF18

Full Name

Fibroblast growth factor 18

Weight

23.989kDa

Superfamily

heparin-binding growth factors family

Alternative Names

FGFI, zFGF5 FGF18 FGF-18, ZFGF5 fibroblast growth factor 18 fibroblast growth factor 18

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FGF18, check out the FGF18 Infographic

FGF18 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FGF18: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO76093-3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Human recombinant FGF-18 (Fibroblast growth factor-18) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Human recombinant FGF-18 (Fibroblast growth factor-18) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Human recombinant FGF-18 (Fibroblast growth factor-18) protein, AF

Size

Total: $77

SKU:PROTO76093-3

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTO76093-3
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.