Click image to see more details
Product Info Summary
| SKU: | PROTQ92914-1 |
|---|---|
| Size: | 5ug,20ug,100ug,500ug,1mg |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant FGF-11 isoform 2 (Fibroblast growth factor-11 isoform 2) protein, AF
View all FGF-11 recombinant proteins
SKU/Catalog Number
PROTQ92914-1
Size
5ug,20ug,100ug,500ug,1mg
Tag
His Tag (C-term)
Description
The Fibroblast Growth Factors (FGF) family has two group, secreted FGFs and intracellular FGFs (iFGFs). iFGFs are related to voltage-gated sodium (Nav) channels. Human FGF-11 isoform 2 is a 18 kDa cytokine with 166 amino acid residues.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant FGF-11 isoform 2 (Fibroblast growth factor-11 isoform 2) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ92914-1)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
25.005kDa
Molecular weight
The protein has a calculated MW of 19.34 kDa. The protein migrates as 23 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <1 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MSLSPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSVPEASPSSPPAP with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human FGF-11 isoform 2
Protein Target Info & Infographic
Gene/Protein Information For FGF11 (Source: Uniprot.org, NCBI)
Gene Name
FGF11
Full Name
Fibroblast growth factor 11
Weight
25.005kDa
Superfamily
heparin-binding growth factors family
Alternative Names
FHF-3, FHF3 FGF11 FGF-11, FHF-3, FHF3 fibroblast growth factor 11 fibroblast growth factor 11|fibroblast growth factor homologous factor 3
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on FGF11, check out the FGF11 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for FGF11: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant FGF-11 isoform 2 (Fibroblast growth factor-11 isoform 2) protein, AF (PROTQ92914-1)
Hello CJ!
No publications found for PROTQ92914-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant FGF-11 isoform 2 (Fibroblast growth factor-11 isoform 2) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant FGF-11 isoform 2 (Fibroblast growth factor-11 isoform 2) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
