Human recombinant CXCL3 (C-X-C motif chemokine 3) protein, AF

CXCL3/GRO gamma/CINC-2/DCIP-1 protein, Human

C-X-C motif chemokine 3 (CXCL3) also named Growth-regulated oncogene gamma (GROγ), which is a chemokine of the intercrine alpha family. CXCL3 is a 8kDa protein containing 73 amino acid residues. During inflammation, CXCL3 is activated by the TNF and IL-1 which mediates the monocytes migration and adhesion by targeting the CXCR2. CXCL3 activates the JNK activity which induce the cell differentiation.

Product Info Summary

SKU: PROTP19876-4
Size: 5ug,20ug,100ug
Origin Species: Human
Source: Escherichia coli
Application: Cell Culture

Product Name

Human recombinant CXCL3 (C-X-C motif chemokine 3) protein, AF

View all CXCL3/GRO gamma/CINC-2/DCIP-1 recombinant proteins

SKU/Catalog Number

PROTP19876-4

Size

5ug,20ug,100ug

Tag

His Tag (N-term)

Description

C-X-C motif chemokine 3 (CXCL3) also named Growth-regulated oncogene gamma (GROγ), which is a chemokine of the intercrine alpha family. CXCL3 is a 8kDa protein containing 73 amino acid residues. During inflammation, CXCL3 is activated by the TNF and IL-1 which mediates the monocytes migration and adhesion by targeting the CXCR2. CXCL3 activates the JNK activity which induce the cell differentiation.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Human recombinant CXCL3 (C-X-C motif chemokine 3) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP19876-4)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

11.342kDa

Molecular weight

The protein has a calculated MW of 8.67 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <2 ng/mL.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN with polyhistidine tag at the N-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For CXCL3 (Source: Uniprot.org, NCBI)

Gene Name

CXCL3

Full Name

C-X-C motif chemokine 3

Weight

11.342kDa

Superfamily

intercrine alpha (chemokine CxC) family

Alternative Names

GRO-γ: MGSAγ, MIP-2β, GRO3 CXCL3 CINC-2b, GRO3, GROg, MIP-2b, MIP2B, SCYB3 C-X-C motif chemokine ligand 3 C-X-C motif chemokine 3|GRO-gamma|GRO-gamma(1-73)|GRO3 oncogene|MGSA gamma|MIP2-beta|chemokine (C-X-C motif) ligand 3|growth-regulated protein gamma|macrophage inflammatory protein 2-beta|melanoma growth stimulatory activity gamma

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CXCL3, check out the CXCL3 Infographic

CXCL3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CXCL3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP19876-4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Human recombinant CXCL3 (C-X-C motif chemokine 3) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Human recombinant CXCL3 (C-X-C motif chemokine 3) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Human recombinant CXCL3 (C-X-C motif chemokine 3) protein, AF

Size

Total: $77

SKU:PROTP19876-4

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP19876-4
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.