Click image to see more details
Product Info Summary
| SKU: | PROTP32971-5 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant CD30L (CD30 ligand) protein, AF
View all CD30 Ligand/TNFSF8 recombinant proteins
SKU/Catalog Number
PROTP32971-5
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Human CD30L is also named for CD153 and TNFSF8 which is one member of TNF family. Human CD30L is expressed on T cells. It binds the CD30, which is on some lymphoma cell lines. Human CD30L is a 30 kDa cytokine with 171 amino acid residues which is a transmembrane glycoprotein. Human CD30L plays an important role in the regulation of cell proliferation, activation and apoptosis. Human CD30L is a good target of cell therapy in inflammatory diseases.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant CD30L (CD30 ligand) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP32971-5)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
26.017kDa
Molecular weight
The protein has a calculated MW of 20.57 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce IL-8 secretion in human PBMCs using a concentration range of 10 - 100 ng/mL. Note: Results may vary from different PBMC donors.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human CD30L
Protein Target Info & Infographic
Gene/Protein Information For TNFSF8 (Source: Uniprot.org, NCBI)
Gene Name
TNFSF8
Full Name
Tumor necrosis factor ligand superfamily member 8
Weight
26.017kDa
Superfamily
tumor necrosis factor family
Alternative Names
soluble CD30 Ligand, TNFSF8, CD153, sCD30 Ligand TNFSF8 CD153, CD30L, CD30LG, TNLG3A TNF superfamily member 8 tumor necrosis factor ligand superfamily member 8|CD153 |CD30 ligand|CD30 ligand|CD30-L|tumor necrosis factor (ligand) superfamily, member 8|tumor necrosis factor ligand 3A|tumor necrosis factor superfamily member 8
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on TNFSF8, check out the TNFSF8 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for TNFSF8: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant CD30L (CD30 ligand) protein, AF (PROTP32971-5)
Hello CJ!
No publications found for PROTP32971-5
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant CD30L (CD30 ligand) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant CD30L (CD30 ligand) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
