Click image to see more details
Product Info Summary
| SKU: | PROTP09529-3 |
|---|---|
| Size: | 5ug,20ug,100ug,500ug,1mg |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant Activin B protein, AF
View all Activin B/Inhibin beta B recombinant proteins
SKU/Catalog Number
PROTP09529-3
Size
5ug,20ug,100ug,500ug,1mg
Tag
His Tag (C-term)
Description
Activin B is the cytokine of the TGF-beta family, which is a 13 kDa protein containing 115 amino acid residues. Activin B has the wide variety of biological function including stem cell differentiation, inflammation, bone remodeling and neural development. They also have a role in regulation of FSH secretion. Activin B induces the phosphorylation of Smad which binds the smad binding element.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant Activin B protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP09529-3)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
45.122kDa
Molecular weight
The protein has a calculated MW of 13.75 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce hemoglobin expression in K562 cells. The ED₅₀ for this effect is <0.7 ng/mL. The specific activity of recombinant human Activin B is > 1.5 x 10⁶ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human Activin B
Protein Target Info & Infographic
Gene/Protein Information For INHBB (Source: Uniprot.org, NCBI)
Gene Name
INHBB
Full Name
Inhibin beta B chain
Weight
45.122kDa
Superfamily
TGF-beta family
Alternative Names
Activin Beta B, INHBB; inhibin beta B chain INHBB inhibin subunit beta B inhibin beta B chain|Inhibin, beta-2|activin AB beta polypeptide|activin beta-B chain|inhibin beta B subunit
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on INHBB, check out the INHBB Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for INHBB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant Activin B protein, AF (PROTP09529-3)
Hello CJ!
No publications found for PROTP09529-3
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant Activin B protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant Activin B protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
