HSPC150 (UBE2T) (NM_014176) Human Recombinant Protein

UBE2T protein,

Product Info Summary

SKU: PROTQ9NPD8
Size: 20 µg
Source: HEK293T

Product Name

HSPC150 (UBE2T) (NM_014176) Human Recombinant Protein

View all UBE2T recombinant proteins

SKU/Catalog Number

PROTQ9NPD8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ubiquitin-conjugating enzyme E2T (putative) (UBE2T)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HSPC150 (UBE2T) (NM_014176) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NPD8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.3 kDa

Amino Acid Sequence

MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV

Validation Images & Assay Conditions

Gene/Protein Information For UBE2T (Source: Uniprot.org, NCBI)

Gene Name

UBE2T

Full Name

Ubiquitin-conjugating enzyme E2 T

Weight

22.3 kDa

Superfamily

ubiquitin-conjugating enzyme family

Alternative Names

Cell proliferation-inducing gene 50 protein; EC 6.3.2.19; HSPC150 protein similar to ubiquitin-conjugating enzyme; HSPC150; PIG50; UBE2T; Ubiquitin carrier protein T; ubiquitin conjugating enzyme; ubiquitin-conjugating enzyme E2 T; ubiquitin-conjugating enzyme E2T (putative); Ubiquitin-protein ligase T UBE2T FANCT, HSPC150, PIG50 ubiquitin conjugating enzyme E2 T ubiquitin-conjugating enzyme E2 T|E2 ubiquitin-conjugating enzyme T|HSPC150 protein similar to ubiquitin-conjugating enzyme|cell proliferation-inducing gene 50 protein|ubiquitin carrier protein T|ubiquitin conjugating enzyme E2T|ubiquitin-conjugating enzyme E2T (putative)|ubiquitin-protein ligase T

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UBE2T, check out the UBE2T Infographic

UBE2T infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UBE2T: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NPD8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HSPC150 (UBE2T) (NM_014176) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HSPC150 (UBE2T) (NM_014176) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HSPC150 (UBE2T) (NM_014176) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NPD8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.