HSPB2 (NM_001541) Human Recombinant Protein

Hspb2 protein,

Product Info Summary

SKU: PROTQ16082
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HSPB2 (NM_001541) Human Recombinant Protein

View all Hspb2 recombinant proteins

SKU/Catalog Number

PROTQ16082

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human heat shock 27kDa protein 2 (HSPB2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HSPB2 (NM_001541) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ16082)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.1 kDa

Amino Acid Sequence

MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP

Validation Images & Assay Conditions

Gene/Protein Information For HSPB2 (Source: Uniprot.org, NCBI)

Gene Name

HSPB2

Full Name

Heat shock protein beta-2

Weight

20.1 kDa

Superfamily

small heat shock protein (HSP20) family

Alternative Names

10 kDa chaperonin; 10 kDa heat shock protein, mitochondrial; Chaperonin 10 Homolog; Chaperonin 10; CPN10HSP10; Early-pregnancy factor; EPF; GroES; heat shock 10kD protein 1 (chaperonin 10); heat shock 10kDa protein 1 (chaperonin 10); HSP10; HSPE1 HSPB2 HSP27, Hs.78846, LOH11CR1K, MKBP heat shock protein family B (small) member 2 heat shock protein beta-2|DMPK-binding protein|heat shock 27kDa protein 2|heat-shock protein beta-2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HSPB2, check out the HSPB2 Infographic

HSPB2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HSPB2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ16082

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HSPB2 (NM_001541) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HSPB2 (NM_001541) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HSPB2 (NM_001541) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ16082
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.