HRASLS3 (PLA2G16) (NM_001128203) Human Recombinant Protein

PLAAT3 protein,

Product Info Summary

SKU: PROTP53816
Size: 20 µg
Source: HEK293T

Product Name

HRASLS3 (PLA2G16) (NM_001128203) Human Recombinant Protein

View all PLAAT3 recombinant proteins

SKU/Catalog Number

PROTP53816

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human phospholipase A2, group XVI (PLA2G16), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HRASLS3 (PLA2G16) (NM_001128203) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP53816)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.8 kDa

Amino Acid Sequence

MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For PLAAT3 (Source: Uniprot.org, NCBI)

Gene Name

PLAAT3

Full Name

Phospholipase A and acyltransferase 3

Weight

17.8 kDa

Superfamily

H-rev107 family

Alternative Names

Phospholipase A and acyltransferase 3 PLAAT3 AdPLA, H-REV107, H-REV107-1, HRASLS3, HREV107, HREV107-1, HREV107-3, HRSL3, PLA2G16, PLAAT-3 phospholipase A and acyltransferase 3 phospholipase A and acyltransferase 3|Ca-independent phospholipase A1/2|H-rev 107 protein homolog|HRAS-like suppressor 1|HRAS-like suppressor 3|adipose-specific PLA2|adipose-specific phospholipase A2|group XVI phospholipase A1/A2|group XVI phospholipase A2|phospholipase A/acyltransferase-3|phospholipase A2 group XVI|renal carcinoma NY-REN-65

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PLAAT3, check out the PLAAT3 Infographic

PLAAT3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PLAAT3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP53816

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HRASLS3 (PLA2G16) (NM_001128203) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HRASLS3 (PLA2G16) (NM_001128203) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HRASLS3 (PLA2G16) (NM_001128203) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP53816
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.