HP1 gamma (CBX3) (NM_016587) Human Recombinant Protein

CBX3 protein,

Product Info Summary

SKU: PROTQ13185
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HP1 gamma (CBX3) (NM_016587) Human Recombinant Protein

View all CBX3 recombinant proteins

SKU/Catalog Number

PROTQ13185

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromobox homolog 3 (HP1 gamma homolog, Drosophila) (CBX3), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HP1 gamma (CBX3) (NM_016587) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13185)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.6 kDa

Amino Acid Sequence

MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ

Validation Images & Assay Conditions

Gene/Protein Information For CBX3 (Source: Uniprot.org, NCBI)

Gene Name

CBX3

Full Name

Chromobox protein homolog 3

Weight

20.6 kDa

Alternative Names

chromobox homolog 3 (Drosophila HP1 gamma); chromobox homolog 3; chromobox protein homolog 3; Drosophila); HECH; Heterochromatin protein 1 homolog gamma; heterochromatin protein HP1 gamma; heterochromatin-like protein 1; HP1 gamma homolog; HP1 gamma; HP1-GAMMA; Modifier 2 protein CBX3 HECH, HP1-GAMMA, HP1Hs-gamma chromobox 3 chromobox protein homolog 3|HP1 gamma homolog|chromobox homolog 3 (HP1 gamma homolog, Drosophila)|heterochromatin protein 1 homolog gamma|heterochromatin protein HP1 gamma|heterochromatin-like protein 1|modifier 2 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CBX3, check out the CBX3 Infographic

CBX3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CBX3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13185

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HP1 gamma (CBX3) (NM_016587) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HP1 gamma (CBX3) (NM_016587) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HP1 gamma (CBX3) (NM_016587) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13185
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.