HOXC9 (NM_006897) Human Recombinant Protein

HOXC9 protein,

Recombinant protein of human homeobox C9 (HOXC9)

Product Info Summary

SKU: PROTP31274
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HOXC9 (NM_006897) Human Recombinant Protein

View all HOXC9 recombinant proteins

SKU/Catalog Number

PROTP31274

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human homeobox C9 (HOXC9)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HOXC9 (NM_006897) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP31274)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

29.1 kDa

Amino Acid Sequence

MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPAVFSTSWAPVPSQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAYPGRRADCGPGEGRSYPDYMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQS

Validation Images & Assay Conditions

Gene/Protein Information For HOXC9 (Source: Uniprot.org, NCBI)

Gene Name

HOXC9

Full Name

Homeobox protein Hox-C9

Weight

29.1 kDa

Superfamily

Abd-B homeobox family

Alternative Names

homeobox C9; Homeobox protein Hox-3B; homeobox protein Hox-C9; HOX3; HOX3Bhomeo box C9 HOXC9 HOX3, HOX3B homeobox C9 homeobox protein Hox-C9|homeo box C9|homeobox protein Hox-3B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HOXC9, check out the HOXC9 Infographic

HOXC9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HOXC9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP31274

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HOXC9 (NM_006897) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HOXC9 (NM_006897) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HOXC9 (NM_006897) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP31274
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product