HOPX (NM_139211) Human Recombinant Protein

HOP protein,

Product Info Summary

SKU: PROTQ9BPY8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HOPX (NM_139211) Human Recombinant Protein

View all HOP recombinant proteins

SKU/Catalog Number

PROTQ9BPY8

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens HOP homeobox (HOPX), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HOPX (NM_139211) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BPY8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

8.1 kDa

Amino Acid Sequence

MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID

Validation Images & Assay Conditions

Gene/Protein Information For Hopx (Source: Uniprot.org, NCBI)

Gene Name

Hopx

Full Name

Homeodomain-only protein

Weight

8.1 kDa

Alternative Names

CAMEO; HOD; homeodomain-only protein; HOP homeobox; HOPLAGYNECC1OB1SMAP31; Lung cancer-associated Y protein; MGC20820; not expressed in choriocarcinoma clone 1; Not expressed in choriocarcinoma protein 1; odd homeobox 1 protein; Odd homeobox protein 1; TOTO Hopx|1110018K11Rik, 1200015P04Rik, 2300002F06Rik, AI848177, AW490897, Cam, Cameo, H, Hdop, Ho, Hod, Hop, Ob, Ob1, Obl, To, Toto|HOP homeobox|homeodomain-only protein|homeobox only domain|homeobox-only protein|mOB1|odd homeobox 1|odd homeobox protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Hopx, check out the Hopx Infographic

Hopx infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Hopx: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BPY8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HOPX (NM_139211) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HOPX (NM_139211) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HOPX (NM_139211) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BPY8
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.