HEPC (HAMP) (NM_021175) Human Recombinant Protein

Hepcidin Antimicrobial Peptide protein,

Recombinant protein of human hepcidin antimicrobial peptide (HAMP)

Product Info Summary

SKU: PROTP81172
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HEPC (HAMP) (NM_021175) Human Recombinant Protein

View all Hepcidin Antimicrobial Peptide recombinant proteins

SKU/Catalog Number

PROTP81172

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human hepcidin antimicrobial peptide (HAMP)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HEPC (HAMP) (NM_021175) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP81172)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

6.9 kDa

Amino Acid Sequence

MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT

Validation Images & Assay Conditions

Gene/Protein Information For HAMP (Source: Uniprot.org, NCBI)

Gene Name

HAMP

Full Name

Hepcidin

Weight

6.9 kDa

Superfamily

hepcidin family

Alternative Names

HAMP; HEPC; hepcidin antimicrobial peptide; Hepcidin; HEPCPutative liver tumor regressor; HFE2B; HFE2Bhepcidin; LEAP1; LEAP-1; LEAP1PLTR; Liver-expressed antimicrobial peptide 1; PLTR HAMP HEPC, HFE2B, LEAP1, PLTR hepcidin antimicrobial peptide hepcidin|hepcidin preproprotein|liver-expressed antimicrobial peptide 1|putative liver tumor regressor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HAMP, check out the HAMP Infographic

HAMP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HAMP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP81172

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HEPC (HAMP) (NM_021175) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HEPC (HAMP) (NM_021175) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HEPC (HAMP) (NM_021175) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP81172
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.