GCNT2 (NM_145655) Human Recombinant Protein

GCNT2 protein,

Recombinant protein of human glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) (GCNT2), transcript variant 3

Product Info Summary

SKU: PROTQ8N0V5
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

GCNT2 (NM_145655) Human Recombinant Protein

View all GCNT2 recombinant proteins

SKU/Catalog Number

PROTQ8N0V5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) (GCNT2), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GCNT2 (NM_145655) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8N0V5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

46.4 kDa

Amino Acid Sequence

MNFWRYCFFAFTLLSVVIFVRFYSSQLSPPKSYEKLNSSSERYFRKTACNHALEKMPVFLWENILPSPLRSVPCKDYLTQNHYITSPLSEEEAAFPLAYVMVIHKDFDTFERLFRAIYMPQNVYCVHVDEKAPAEYKESVRQLLSCFQNAFIASKTESVVYAGISRLQADLNCLKDLVASEVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTREFVDFVLRDQRAIDLLQWSKDTYSPDEHFWVTLNRVSGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For GCNT2 (Source: Uniprot.org, NCBI)

Gene Name

GCNT2

Full Name

N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase

Weight

46.4 kDa

Superfamily

glycosyltransferase 14 family

Alternative Names

bA360O19.2; bA421M1.1; beta-1,6-N-acetylglucosaminyltransferase 2; cataract, congenital; CCAT; EC 2.4.1.150; GCNT2C; GCNT5; glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group); glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (Ii blood group); glucosaminyl (N-acetyl) transferase 2, I-branching enzyme; I beta-1,6-N-acetylglucosaminyltransferase; I-branching beta-1,6-acetylglucosaminyltransferase; I-branching enzyme; IGNTglucosaminyl (N-acetyl) transferase 5; Ii blood group; II; MGC163396; N-acetylglucosaminyltransferase; N-acetyllactosaminide beta-1,6-N-acetylgluc GCNT2 CCAT, CTRCT13C, GCNT5, IGNT, II, NACGT1, NAGCT1, ULG3, bA360O19.2, bA421M1.1, GCNT2 glucosaminyl (N-acetyl) transferase 2 (I blood group) N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase|I beta-1,6-N-acetylglucosaminyltransferase|Ii blood group|beta-1,6-N-acetylglucosaminyltransferase 2|glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GCNT2, check out the GCNT2 Infographic

GCNT2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GCNT2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8N0V5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GCNT2 (NM_145655) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GCNT2 (NM_145655) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GCNT2 (NM_145655) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8N0V5
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.