GSTA4 (NM_001512) Human Recombinant Protein

GSTA4 protein,

Product Info Summary

SKU: PROTO15217
Size: 20 µg
Source: HEK293T

Product Name

GSTA4 (NM_001512) Human Recombinant Protein

View all GSTA4 recombinant proteins

SKU/Catalog Number

PROTO15217

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human glutathione S-transferase alpha 4 (GSTA4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GSTA4 (NM_001512) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO15217)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.5 kDa

Amino Acid Sequence

MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP

Validation Images & Assay Conditions

Gene/Protein Information For GSTA4 (Source: Uniprot.org, NCBI)

Gene Name

GSTA4

Full Name

Glutathione S-transferase A4

Weight

25.5 kDa

Superfamily

GST superfamily

Alternative Names

DKFZp686D21185; EC 2.5.1.18; glutathione S-alkyltransferase A4; glutathione S-aralkyltransferase A4; glutathione S-aryltransferase A4; glutathione S-transferase A4; Glutathione S-transferase A4-4; glutathione S-transferase alpha 4; glutathione transferase A4-4; GST class-alpha member 4; GSTA4-4; GTA4; S-(hydroxyalkyl)glutathione lyase A4 GSTA4 GSTA4-4, GTA4 glutathione S-transferase alpha 4 glutathione S-transferase A4|GST class-alpha member 4|S-(hydroxyalkyl)glutathione lyase A4|glutathione S-alkyltransferase A4|glutathione S-aralkyltransferase A4|glutathione S-aryltransferase A4|glutathione S-transferase A4-4|glutathione transferase A4-4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GSTA4, check out the GSTA4 Infographic

GSTA4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GSTA4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO15217

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GSTA4 (NM_001512) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GSTA4 (NM_001512) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GSTA4 (NM_001512) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO15217
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.