Granzyme A (GZMA) (NM_006144) Human Recombinant Protein

Granzyme A protein,

Recombinant protein of human granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) (GZMA)

Product Info Summary

SKU: PROTP12544
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Granzyme A (GZMA) (NM_006144) Human Recombinant Protein

View all Granzyme A recombinant proteins

SKU/Catalog Number

PROTP12544

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) (GZMA)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Granzyme A (GZMA) (NM_006144) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP12544)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

28.8 kDa

Amino Acid Sequence

MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV

Validation Images & Assay Conditions

Gene/Protein Information For GZMA (Source: Uniprot.org, NCBI)

Gene Name

GZMA

Full Name

Granzyme A

Weight

28.8 kDa

Superfamily

peptidase S1 family

Alternative Names

CTL Tryptase; CTLA3; CTLA3Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factorserine protease); Cytotoxic T-lymphocyte proteinase 1; EC 3.4.21; Fragmentin-1; granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3); Granzyme A; Granzyme-1; GZMA; H factor; Hanukkah factor; HF; HFSP; HFSPEC 3.4.21.78 GZMA CTLA3, HFSP granzyme A granzyme A|CTL tryptase|Cytotoxic T-lymphocyte-associated serine esterase-3|Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factor serine protease)|HF|Hanukah factor serine protease)|cytotoxic T-lymphocyte proteinase 1|fragmentin-1|granzyme 1|granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3)|h factor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GZMA, check out the GZMA Infographic

GZMA infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GZMA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP12544

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Granzyme A (GZMA) (NM_006144) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Granzyme A (GZMA) (NM_006144) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Granzyme A (GZMA) (NM_006144) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP12544
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.