GPSM3 (NM_022107) Human Recombinant Protein

GPSM3 protein,

Recombinant protein of human G-protein signaling modulator 3 (AGS3-like, C. elegans) (GPSM3)

Product Info Summary

SKU: PROTQ9Y4H4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

GPSM3 (NM_022107) Human Recombinant Protein

View all GPSM3 recombinant proteins

SKU/Catalog Number

PROTQ9Y4H4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human G-protein signaling modulator 3 (AGS3-like, C. elegans) (GPSM3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GPSM3 (NM_022107) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y4H4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.7 kDa

Amino Acid Sequence

MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSLQTELLLDLVAEAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRMEAQRSEPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC

Validation Images & Assay Conditions

Gene/Protein Information For GPSM3 (Source: Uniprot.org, NCBI)

Gene Name

GPSM3

Full Name

G-protein-signaling modulator 3

Weight

17.7 kDa

Alternative Names

Activator of G-protein signaling 4; AGS4C6orf9; G18.1bC. elegans); G18.2; G18chromosome 6 open reading frame 9; G-protein signaling modulator 3; G-protein signalling modulator 3 (AGS3-like, C. elegans); G-protein-signaling modulator 3; NG1; Protein G18 GPSM3 AGS4, C6orf9, G18, G18.1a, G18.1b, G18.2, NG1 G protein signaling modulator 3 G-protein-signaling modulator 3|G-protein signaling modulator 3 (AGS3-like, C. elegans)|G-protein signalling modulator 3 (AGS3-like, C. elegans)|activator of G-protein signaling 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GPSM3, check out the GPSM3 Infographic

GPSM3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GPSM3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y4H4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GPSM3 (NM_022107) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GPSM3 (NM_022107) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GPSM3 (NM_022107) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y4H4
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.