GNPTG (NM_032520) Human Recombinant Protein

GNPTG protein,

Recombinant protein of human N-acetylglucosamine-1-phosphate transferase, gamma subunit (GNPTG)

Product Info Summary

SKU: PROTQ9UJJ9
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

GNPTG (NM_032520) Human Recombinant Protein

View all GNPTG recombinant proteins

SKU/Catalog Number

PROTQ9UJJ9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human N-acetylglucosamine-1-phosphate transferase, gamma subunit (GNPTG)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GNPTG (NM_032520) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UJJ9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33.8 kDa

Amino Acid Sequence

MAAGLARLLLLLGLSAGGPAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGPVHLFRLSGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVELACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRQWDQVEQDLADELITPQGHEKLLRTLFEDAGYLKTPENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLGHETPRAKSPEQLRGDPGLRGSL

Validation Images & Assay Conditions

Gene/Protein Information For GNPTG (Source: Uniprot.org, NCBI)

Gene Name

GNPTG

Full Name

N-acetylglucosamine-1-phosphotransferase subunit gamma

Weight

33.8 kDa

Alternative Names

C16orf27; c316G12.3; CAB56184; GlcNAc-1-phosphotransferase subunit gamma; GNPTAGchromosome 16 open reading frame 27; LP2537; N-acetylglucosamine-1-phosphate transferase, gamma subunit; N-acetylglucosamine-1-phosphotransferase subunit gamma; N-acetylglucosamine-1-phosphotransferase, gamma subunit; RJD9; UDP-N-acetylglucosamine-1-phosphotransferase subunit gamma GNPTG C16orf27, GNPTAG, LP2537, RJD9 N-acetylglucosamine-1-phosphate transferase subunit gamma N-acetylglucosamine-1-phosphotransferase subunit gamma|N-acetylglucosamine-1-phosphate transferase gamma subunit|UDP-N-acetylglucosamine-1-phosphotransferase subunit gamma|glcNAc-1-phosphotransferase subunit gamma

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GNPTG, check out the GNPTG Infographic

GNPTG infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GNPTG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UJJ9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GNPTG (NM_032520) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GNPTG (NM_032520) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GNPTG (NM_032520) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UJJ9
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.