GMFG (NM_004877) Human Recombinant Protein

GMFG protein,

Product Info Summary

SKU: PROTO60234
Size: 20 µg
Source: HEK293T

Product Name

GMFG (NM_004877) Human Recombinant Protein

View all GMFG recombinant proteins

SKU/Catalog Number

PROTO60234

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human glia maturation factor, gamma (GMFG)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GMFG (NM_004877) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO60234)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.6 kDa

Amino Acid Sequence

MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR

Validation Images & Assay Conditions

Gene/Protein Information For GMFG (Source: Uniprot.org, NCBI)

Gene Name

GMFG

Full Name

Glia maturation factor gamma

Weight

16.6 kDa

Superfamily

actin-binding proteins ADF family

Alternative Names

glia maturation factor gamma; glia maturation factor, gamma; GMF-GAMMA; MGC126867 GMFG GMF-GAMMA glia maturation factor gamma glia maturation factor gamma

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GMFG, check out the GMFG Infographic

GMFG infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GMFG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO60234

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GMFG (NM_004877) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GMFG (NM_004877) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GMFG (NM_004877) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO60234
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product