GM CSF Receptor alpha (CSF2RA) (NM_172245) Human Recombinant Protein

GM-CSFR alpha protein,

Product Info Summary

SKU: PROTP15509
Size: 20 µg
Source: HEK293T

Product Name

GM CSF Receptor alpha (CSF2RA) (NM_172245) Human Recombinant Protein

View all GM-CSFR alpha recombinant proteins

SKU/Catalog Number

PROTP15509

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GM CSF Receptor alpha (CSF2RA) (NM_172245) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP15509)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

44.1 kDa

Amino Acid Sequence

MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT

Validation Images & Assay Conditions

Gene/Protein Information For CSF2RA (Source: Uniprot.org, NCBI)

Gene Name

CSF2RA

Full Name

Granulocyte-macrophage colony-stimulating factor receptor subunit alpha

Weight

44.1 kDa

Superfamily

type I cytokine receptor family

Alternative Names

CD116 antigen; CD116; CDw116; colony stimulating factor 2 receptor alpha subunit; colony stimulating factor 2 receptor, alpha, low-affinity(granulocyte-macrophage); CSF2R; CSF2RA; CSF2RAX; CSF2RAY; CSF2RX; CSF2RY; GM-CSF R alpha; GM-CSF receptor alpha subunit; GMCSFR alpha; GMCSFR; GM-CSFRa; GM-CSF-R-alpha; GMCSFR-alpha; GMR; GMR-alpha; granulocyte-macrophage colony-stimulating factor receptor alpha chain; granulocyte-macrophage colony-stimulating factor receptor subunit alpha; MGC3848; MGC4838 CSF2RA CD116, CDw116, CSF2RX, CSF2RAY, CSF2RX, CSF2RY, GM-CSF-R-alpha, GMCSFR, GMCSFR-alpha, GMR, GMR-alpha, SMDP4, alphaGMR, CSF2RA colony stimulating factor 2 receptor subunit alpha granulocyte-macrophage colony-stimulating factor receptor subunit alpha|CD116 |GM-CSF receptor alpha subunit|alpha-GM-CSF receptor|colony stimulating factor 2 receptor alpha subunit|colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage)|granulocyte-macrophage colony-stimulating factor receptor alpha chain

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CSF2RA, check out the CSF2RA Infographic

CSF2RA infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CSF2RA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP15509

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GM CSF Receptor alpha (CSF2RA) (NM_172245) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GM CSF Receptor alpha (CSF2RA) (NM_172245) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GM CSF Receptor alpha (CSF2RA) (NM_172245) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP15509
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.