GDI2 (NM_001494) Human Recombinant Protein

GDI2 protein,

Product Info Summary

SKU: PROTP50395
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

GDI2 (NM_001494) Human Recombinant Protein

View all GDI2 recombinant proteins

SKU/Catalog Number

PROTP50395

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human GDP dissociation inhibitor 2 (GDI2), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GDI2 (NM_001494) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP50395)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

50.5 kDa

Amino Acid Sequence

MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED

Validation Images & Assay Conditions

Gene/Protein Information For GDI2 (Source: Uniprot.org, NCBI)

Gene Name

GDI2

Full Name

Rab GDP dissociation inhibitor beta

Weight

50.5 kDa

Superfamily

Rab GDI family

Alternative Names

beta; FLJ16452; GDP dissociation inhibitor 2; Guanosine diphosphate dissociation inhibitor 2; RABGDIBFLJ37352 GDI2 HEL-S-46e, RABGDIB GDP dissociation inhibitor 2 rab GDP dissociation inhibitor beta|GDI-2|epididymis secretory sperm binding protein Li 46e|guanosine diphosphate dissociation inhibitor 2|rab GDI beta|rab GDP-dissociation inhibitor, beta

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GDI2, check out the GDI2 Infographic

GDI2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GDI2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP50395

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GDI2 (NM_001494) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GDI2 (NM_001494) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GDI2 (NM_001494) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP50395
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.