GCAP1 (GUCA1A) (NM_000409) Human Recombinant Protein

GCAP1 protein,

Recombinant protein of human guanylate cyclase activator 1A (retina) (GUCA1A)

Product Info Summary

SKU: PROTP43080
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

GCAP1 (GUCA1A) (NM_000409) Human Recombinant Protein

View all GCAP1 recombinant proteins

SKU/Catalog Number

PROTP43080

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human guanylate cyclase activator 1A (retina) (GUCA1A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GCAP1 (GUCA1A) (NM_000409) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP43080)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.7 kDa

Amino Acid Sequence

MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG

Validation Images & Assay Conditions

Gene/Protein Information For GUCA1A (Source: Uniprot.org, NCBI)

Gene Name

GUCA1A

Full Name

Guanylyl cyclase-activating protein 1

Weight

22.7 kDa

Alternative Names

C6orf131; chromosome 6 open reading frame 131; CORD14; GCAP 1; GCAP1photoreceptor 1; GCAPGUCA; guanylate cyclase activator 1A (retina); Guanylate cyclase activator 1A; guanylin 1, retina; guanylyl cyclase-activating protein 1; GUCA1 GUCA1A C6orf131, COD3, CORD14, GCAP, GCAP1, GUCA, GUCA1 guanylate cyclase activator 1A guanylyl cyclase-activating protein 1|cone dystrophy 3|guanylate cyclase-activating protein, photoreceptor 1|guanylin 1, retina

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GUCA1A, check out the GUCA1A Infographic

GUCA1A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GUCA1A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP43080

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GCAP1 (GUCA1A) (NM_000409) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GCAP1 (GUCA1A) (NM_000409) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GCAP1 (GUCA1A) (NM_000409) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP43080
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.