GBE1 (NM_000158) Human Recombinant Protein

GBE1 protein,

Recombinant protein of human glucan (1,4-alpha-), branching enzyme 1 (GBE1)

Product Info Summary

SKU: PROTQ04446
Size: 20 µg
Source: HEK293T

Product Name

GBE1 (NM_000158) Human Recombinant Protein

View all GBE1 recombinant proteins

SKU/Catalog Number

PROTQ04446

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human glucan (1,4-alpha-), branching enzyme 1 (GBE1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GBE1 (NM_000158) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ04446)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

80.3 kDa

Amino Acid Sequence

MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGSPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEVLRFLLSNIRWWLEEYRFDGFRFDGVTSMLYHHHGVGQGFSGDYSEYFGLQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPALCSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESHDQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAPQAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDLPN

Validation Images & Assay Conditions

Gene/Protein Information For GBE1 (Source: Uniprot.org, NCBI)

Gene Name

GBE1

Full Name

1,4-alpha-glucan-branching enzyme

Weight

80.3 kDa

Superfamily

glycosyl hydrolase 13 family

Alternative Names

1,4-alpha-glucan-branching enzyme; amylo-(1,4 to 1,6) transglucosidase; amylo-(1,4 to 1,6) transglycosylase; Brancher enzyme; EC 2.4.1.18; GBE; glucan (1,4-alpha), branching enzyme 1; glycogen branching enzyme; Glycogen-branching enzyme GBE1 APBD, GBE, GSD4 1,4-alpha-glucan branching enzyme 1 1,4-alpha-glucan-branching enzyme|amylo-(1,4 to 1,6) transglucosidase|amylo-(1,4 to 1,6) transglycosylase|brancher enzyme|glucan (1,4-alpha-), branching enzyme 1|glycogen branching enzyme

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GBE1, check out the GBE1 Infographic

GBE1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GBE1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ04446

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GBE1 (NM_000158) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GBE1 (NM_000158) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GBE1 (NM_000158) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ04446
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.