Galanin (GAL) (NM_015973) Human Recombinant Protein

Galanin protein,

Product Info Summary

SKU: PROTP22466
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Galanin (GAL) (NM_015973) Human Recombinant Protein

View all Galanin recombinant proteins

SKU/Catalog Number

PROTP22466

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human galanin prepropeptide (GAL)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Galanin (GAL) (NM_015973) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP22466)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.1 kDa

Amino Acid Sequence

MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS

Validation Images & Assay Conditions

Gene/Protein Information For GAL (Source: Uniprot.org, NCBI)

Gene Name

GAL

Full Name

Galanin peptides

Weight

13.1 kDa

Superfamily

galanin family

Alternative Names

GAL; GAL1; galanin prepropeptide; Galanin; GALN; GALNgalanin-related peptide; GLNNgalanin-message-associated peptide; GMAP; MGC40167 Gal|Gn, Gal|galanin and GMAP prepropeptide|galanin peptides|galanin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GAL, check out the GAL Infographic

GAL infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GAL: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP22466

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Galanin (GAL) (NM_015973) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Galanin (GAL) (NM_015973) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Galanin (GAL) (NM_015973) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP22466
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.