FXYD2 (NM_001680) Human Recombinant Protein

FXYD2 protein,

Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a

Product Info Summary

SKU: PROTP54710
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FXYD2 (NM_001680) Human Recombinant Protein

View all FXYD2 recombinant proteins

SKU/Catalog Number

PROTP54710

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FXYD2 (NM_001680) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP54710)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

7.1 kDa

Amino Acid Sequence

MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

Validation Images & Assay Conditions

Gene/Protein Information For FXYD2 (Source: Uniprot.org, NCBI)

Gene Name

FXYD2

Full Name

Sodium/potassium-transporting ATPase subunit gamma

Weight

7.1 kDa

Superfamily

FXYD family

Alternative Names

ATP1C; ATP1G1ATPase, Na+/K+ transporting, gamma 1 polypeptide; FXYD domain containing ion transport regulator 2; FXYD domain-containing ion transport regulator 2; HOMG2; hypomagnesemia 2, renal; MGC12372; Na(+)/K(+) ATPase subunit gamma; Sodium pump gamma chain; sodium/potassium-transporting ATPase subunit gamma; Sodium-potassium-ATPase, gamma polypeptide FXYD2 ATP1G1, HOMG2 FXYD domain containing ion transport regulator 2 sodium/potassium-transporting ATPase subunit gamma|ATPase, Na+/K+ transporting, gamma 1 polypeptide|Na(+)/K(+) ATPase subunit gamma|sodium pump gamma chain

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FXYD2, check out the FXYD2 Infographic

FXYD2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FXYD2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP54710

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FXYD2 (NM_001680) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FXYD2 (NM_001680) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FXYD2 (NM_001680) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP54710
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.