FGF14 (NM_004115) Human Recombinant Protein

FGF14 protein,

Product Info Summary

SKU: PROTQ92915
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FGF14 (NM_004115) Human Recombinant Protein

View all FGF14 recombinant proteins

SKU/Catalog Number

PROTQ92915

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human fibroblast growth factor 14 (FGF14), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FGF14 (NM_004115) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ92915)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.5 kDa

Amino Acid Sequence

MAAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRRLRRQDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT

Validation Images & Assay Conditions

Gene/Protein Information For FGF14 (Source: Uniprot.org, NCBI)

Gene Name

FGF14

Full Name

Fibroblast growth factor 14

Weight

27.5 kDa

Superfamily

heparin-binding growth factors family

Alternative Names

bA397O8.2; FGF-14; FHF4FHF-4; fibroblast growth factor 14; Fibroblast growth factor homologous factor 4; SCA27MGC119129 FGF14 FGF-14, FHF-4, FHF4, SCA27 fibroblast growth factor 14 fibroblast growth factor 14|fibroblast growth factor homologous factor 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FGF14, check out the FGF14 Infographic

FGF14 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FGF14: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ92915

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FGF14 (NM_004115) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FGF14 (NM_004115) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FGF14 (NM_004115) Human Recombinant Protein

Size

Total: $813

SKU:PROTQ92915

Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ92915
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.