FBXL18 (NM_024963) Human Recombinant Protein

FBXL18 protein,

Recombinant protein of human F-box and leucine-rich repeat protein 18 (FBXL18)

Product Info Summary

SKU: PROTQ96ME1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FBXL18 (NM_024963) Human Recombinant Protein

View all FBXL18 recombinant proteins

SKU/Catalog Number

PROTQ96ME1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human F-box and leucine-rich repeat protein 18 (FBXL18)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FBXL18 (NM_024963) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96ME1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

78.7 kDa

Amino Acid Sequence

MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPSTDLILNVRRTCRKLAALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGCYWLPGSTVEHVARCRSLVKVNLSGCHLTSLRLSKMLSALQHLRSLAIDVSPGFDASQLSSECKATLSRVRELKQTLFTPSYGVVPCCTSLEKLLLYFEILDRTREGAILSGQLMVGQSNVPHYQNLRVFYARLAPGYINQEVVRLYLAVLSDRTPQNLHAFLISVPGSFAESGATKNLLDSMARNVVLDALQLPKSWLNGSSLLQHMKFNNPFYFSFSRCTLSGGHLIQQVINGGKDLRSLASLNLSGCVHCLSPDSLLRKAEDDIDSSILETLVASCCNLRHLNLSAAHHHSSEGLGRHLCQLLARLRHLRSLSLPVCSVADSAPRADRAPAQPAMHAVPRGFGKKVRVGVQSCPSPFSGQACPQPSSVFWSLLKNLPFLEHLELIGSNFSSAMPRNEPAIRNSLPPCSRAQSVGDSEVAAIGQLAFLRHLTLAQLPSVLTGSGLVNIGLQCQQLRSLSLANLGMMGKVVYMPALSDMLKHCKRLRDLRLEQPYFSANAQFFQALSQCPSLQRLCLVSRSGTLQPDAVLAFMARCLQVVMCHLFTGESLATCKSLQQSLLRSFQAERPALNVVIFPLLHEGLTDVIRDVPLVHLDEITLFKSRVAEEPPNLWW

Validation Images & Assay Conditions

Gene/Protein Information For FBXL18 (Source: Uniprot.org, NCBI)

Gene Name

FBXL18

Full Name

F-box/LRR-repeat protein 18

Weight

78.7 kDa

Alternative Names

Fbl18; F-box and leucine-rich repeat protein 18FLJ38075; F-box/LRR-repeat protein 18; FLJ10776; FLJ11467; FLJ26934; FLJ41541 FBXL18 Fbl18 F-box and leucine rich repeat protein 18 F-box/LRR-repeat protein 18

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FBXL18, check out the FBXL18 Infographic

FBXL18 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FBXL18: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96ME1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FBXL18 (NM_024963) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FBXL18 (NM_024963) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FBXL18 (NM_024963) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96ME1
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.