FAM122A (NM_138333) Human Recombinant Protein

Fam122a protein,

Recombinant protein of human family with sequence similarity 122A (FAM122A)

Product Info Summary

SKU: PROTQ96E09
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FAM122A (NM_138333) Human Recombinant Protein

View all Fam122a recombinant proteins

SKU/Catalog Number

PROTQ96E09

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human family with sequence similarity 122A (FAM122A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FAM122A (NM_138333) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96E09)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.3 kDa

Amino Acid Sequence

MAQEKMELDLELPPGTGGSPAEGGGSGGGGGLRRSNSAPLIHGLSDTSPVFQAEAPSARRNSTTFPSRHGLLLPASPVRMHSSRLHQIKQEEGMDLINRETVHEREVQTAMQISHSWEESFSLSDNDVEKSASPKRIDFIPVSPAPSPTRGIGKQCFSPSLQSFVSSNGLPPSPIPSPTTRFTTRRSQSPINCIRPSVLGPLKRKCEMETEYQPKRFFQGITNMLSSDVAQLSDPGVCVSSDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIPLDELSSK

Validation Images & Assay Conditions

Gene/Protein Information For Fam122a (Source: Uniprot.org, NCBI)

Gene Name

Fam122a

Full Name

Protein FAM122A

Weight

30.3 kDa

Superfamily

FAM122 family

Alternative Names

C9orf42; chromosome 9 open reading frame 42; family with sequence similarity 122A; hypothetical protein LOC116224; MGC17347

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Fam122a, check out the Fam122a Infographic

Fam122a infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Fam122a: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96E09

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FAM122A (NM_138333) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FAM122A (NM_138333) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FAM122A (NM_138333) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96E09
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.