EXOSC3 (NM_016042) Human Recombinant Protein

EXOSC3 protein,

Product Info Summary

SKU: PROTQ9NQT5
Size: 20 µg
Source: HEK293T

Product Name

EXOSC3 (NM_016042) Human Recombinant Protein

View all EXOSC3 recombinant proteins

SKU/Catalog Number

PROTQ9NQT5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human exosome component 3 (EXOSC3), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

EXOSC3 (NM_016042) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NQT5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

29.4 kDa

Amino Acid Sequence

MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

Validation Images & Assay Conditions

Gene/Protein Information For EXOSC3 (Source: Uniprot.org, NCBI)

Gene Name

EXOSC3

Full Name

Exosome complex component RRP40

Weight

29.4 kDa

Superfamily

RRP40 family

Alternative Names

bA3J10.7; CGI-102; exosome complex exonuclease RRP40; exosome component 3MGC15120; exosome component Rrp40; hRrp-40; hRrp40p; p10Rrp40p; Ribosomal RNA-processing protein 40; RP11-3J10.8; RRP40MGC723 EXOSC3 CGI-102, PCH1B, RRP40, Rrp40p, bA3J10.7, hRrp-40, p10 exosome component 3 exosome complex component RRP40|exosome complex exonuclease RRP40|ribosomal RNA-processing protein 40

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EXOSC3, check out the EXOSC3 Infographic

EXOSC3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EXOSC3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NQT5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used EXOSC3 (NM_016042) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For EXOSC3 (NM_016042) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for EXOSC3 (NM_016042) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NQT5
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.