Anti-CFP Antibody Picoband™

Properdin antibody

Boster Bio Anti-CFP Antibody Picoband™ catalog # A00852-2. Tested in Flow Cytometry, IHC, IHC-F, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A00852-2
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, IHC-F, WB

Product Name

Anti-CFP Antibody Picoband™

View all Properdin Antibodies

SKU/Catalog Number

A00852-2

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-CFP Antibody Picoband™ catalog # A00852-2. Tested in Flow Cytometry, IHC, IHC-F, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-CFP Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00852-2)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human CFP, which shares 86.1% amino acid (aa) sequence identity with both mouse and rat CFP.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00852-2 is reactive to CFP in Human, Mouse, Rat

Applications

A00852-2 is guaranteed for Flow Cytometry, IHC, IHC-F, WB Boster Guarantee

Observed Molecular Weight

51 kDa

Calculated molecular weight

55914 MW

Background of Properdin

Properdin (factor P) is a plasma protein that is active in the alternative complement pathway of the innate immune system. It is mapped to Xp11.23. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedback loop that ultimately leads to formation of the membrane attack complex and lysis of the target cell. Mutations in this gene result in two forms of properdin deficiency, which results in high susceptibility to meningococcal infections. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Flow Cytometry (Fixed), 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For CFP (Source: Uniprot.org, NCBI)

Gene Name

CFP

Full Name

Properdin

Weight

55914 MW

Alternative Names

BFD; CFP; Complement Factor P; complement factor properdin; PFC; PFCcomplement; PFD; Properdin CFP BFD, PFC, PFD, PROPERDIN complement factor properdin properdin|complement factor P|properdin P factor, complement

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on CFP, check out the CFP Infographic

CFP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CFP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A00852-2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-CFP Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-CFP Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-CFP Antibody Picoband™

Question

We are interested in using your anti-CFP antibody for defense response to bacterium studies. Has this antibody been tested with western blotting on brain tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2020-04-30

Answer

Thanks for your inquiry. This A00852-2 anti-CFP antibody is validated on human cholangiocarcinoma tissue, placenta tissue, rat liver tissue, brain tissue, mouse kidney tissue, liver cancer tissue, intestine tissue. It is guaranteed to work for Flow Cytometry, IHC-P, IHC-F, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2020-04-30

Question

Please see the WB image, lot number and protocol we used for plasma using anti-CFP antibody A00852-2. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-12-20

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-12-20

Question

We are currently using anti-CFP antibody A00852-2 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2019-09-16

Answer

The anti-CFP antibody (A00852-2) has not been validated for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-09-16

Question

Is this A00852-2 anti-CFP antibody reactive to the isotypes of CFP?

Verified Customer

Verified customer

Asked: 2019-09-05

Answer

The immunogen of A00852-2 anti-CFP antibody is A synthetic peptide corresponding to a sequence of human CFP (MVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKR). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-09-05

Question

Is there a BSA free version of anti-CFP antibody A00852-2 available?

Verified Customer

Verified customer

Asked: 2019-08-27

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-CFP antibody A00852-2 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-08-27

Question

Would A00852-2 anti-CFP antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-02-04

Answer

It shows on the product datasheet, A00852-2 anti-CFP antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-02-04

Question

Is a blocking peptide available for product anti-CFP antibody (A00852-2)?

H. Dhar

Verified customer

Asked: 2018-08-16

Answer

We do provide the blocking peptide for product anti-CFP antibody (A00852-2). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-08-16

Question

We have observed staining in human spleen. Any tips? Is anti-CFP antibody supposed to stain spleen positively?

Verified Customer

Verified customer

Asked: 2018-08-14

Answer

From literature spleen does express CFP. From Uniprot.org, CFP is expressed in leukocyte, spleen, plasma, among other tissues. Regarding which tissues have CFP expression, here are a few articles citing expression in various tissues:
Plasma, Pubmed ID: 16335952
Spleen, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2018-08-14

Question

I am interested in to test anti-CFP antibody A00852-2 on rat plasma for research purposes, then I may be interested in using anti-CFP antibody A00852-2 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

S. Baker

Verified customer

Asked: 2018-07-19

Answer

The products we sell, including anti-CFP antibody A00852-2, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-07-19

Question

I was wanting to use your anti-CFP antibody for WB for rat plasma on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat plasma identification?

K. Krishna

Verified customer

Asked: 2018-07-04

Answer

It shows on the product datasheet, A00852-2 anti-CFP antibody has been tested for Flow Cytometry, IHC-P, IHC-F, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat plasma in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-07-04

Question

Does anti-CFP antibody A00852-2 work for WB with plasma?

Verified Customer

Verified customer

Asked: 2018-05-28

Answer

According to the expression profile of plasma, CFP is highly expressed in plasma. So, it is likely that anti-CFP antibody A00852-2 will work for WB with plasma.

Boster Scientific Support

Answered: 2018-05-28

Question

I see that the anti-CFP antibody A00852-2 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2017-11-06

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2017-11-06

Question

Our lab used your anti-CFP antibody for IHC-P on spleen last year. I am using mouse, and I plan to use the antibody for Flow Cytometry next. We need examining spleen as well as leukocyte in our next experiment. Do you have any suggestion on which antibody would work the best for Flow Cytometry?

P. Johnson

Verified customer

Asked: 2016-12-12

Answer

I have checked the website and datasheets of our anti-CFP antibody and it appears that A00852-2 has been validated on mouse in both IHC-P and Flow Cytometry. Thus A00852-2 should work for your application. Our Boster satisfaction guarantee will cover this product for Flow Cytometry in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for Flow Cytometry detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2016-12-12

Question

Our lab were content with the WB result of your anti-CFP antibody. However we have observed positive staining in spleen secreted. using this antibody. Is that expected? Could you tell me where is CFP supposed to be expressed?

M. Evans

Verified customer

Asked: 2015-05-14

Answer

From literature, spleen does express CFP. Generally CFP expresses in secreted. Regarding which tissues have CFP expression, here are a few articles citing expression in various tissues:
Plasma, Pubmed ID: 16335952
Spleen, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2015-05-14

Question

My question regarding product A00852-2, anti-CFP antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

A. Li

Verified customer

Asked: 2015-04-24

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00852-2 anti-CFP antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2015-04-24

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for plasma using anti-CFP antibody A00852-2. Let me know if you need anything else.

R. Brown

Verified customer

Asked: 2014-04-03

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2014-04-03

Order DetailsPrice
A00852-2

100μg

$370
A00852-2-10ug

10μg sample (liquid)

$99
A00852-2-Biotin

100 μg Biotin conjugated

$570
A00852-2-Cy3

100 μg Cy3 conjugated

$570
A00852-2-Dylight488

100 μg Dylight488 conjugated

$570
A00852-2-Dylight550

100 μg Dylight550 conjugated

$570
A00852-2-Dylight594

100 μg Dylight594 conjugated

$570
A00852-2-FITC

100 μg FITC conjugated

$570
A00852-2-HRP

100 μg HRP conjugated

$570
A00852-2-APC

100 μg APC conjugated

$670
A00852-2-PE

100 μg PE conjugated

$670
A00852-2-iFluor647

100 μg iFluor647 conjugated

$670
A00852-2-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00852-2
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.