ErbB 3 (ERBB3) (NM_001005915) Human Recombinant Protein

ErbB3/Her3 protein,

Product Info Summary

SKU: PROTP21860
Size: 20 µg
Source: HEK293T

Product Name

ErbB 3 (ERBB3) (NM_001005915) Human Recombinant Protein

View all ErbB3/Her3 recombinant proteins

SKU/Catalog Number

PROTP21860

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant s

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ErbB 3 (ERBB3) (NM_001005915) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP21860)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.1 kDa

Amino Acid Sequence

MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTGQFPMVPSGLTPQQAQDWYLLDDDPRLLTLSASSKVPVTLAAV

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For ERBB3 (Source: Uniprot.org, NCBI)

Gene Name

ERBB3

Full Name

Receptor tyrosine-protein kinase erbB-3

Weight

18.1 kDa

Superfamily

protein kinase superfamily

Alternative Names

c-erbB3; EC 2.7.10; EC 2.7.10.1; ErbB3; ErbB-3; erbB3-S; HER3; HER3c-erbB-3; LCCS2; lethal congenital contracture syndrome 2; MDA-BF-1; MGC88033; p180-ErbB3; p45-sErbB3; p85-sErbB3; Proto-oncogene-like protein c-ErbB-3; receptor tyrosine-protein kinase erbB-3; Tyrosine kinase-type cell surface receptor HER3; v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) ERBB3 ErbB-3, FERLK, HER3, LCCS2, MDA-BF-1, c-erbB-3, c-erbB3, erbB3-S, p180-ErbB3, p45-sErbB3, p85-sErbB3 erb-b2 receptor tyrosine kinase 3 receptor tyrosine-protein kinase erbB-3|human epidermal growth factor receptor 3|proto-oncogene-like protein c-ErbB-3|tyrosine kinase-type cell surface receptor HER3|v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ERBB3, check out the ERBB3 Infographic

ERBB3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ERBB3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used ErbB 3 (ERBB3) (NM_001005915) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ErbB 3 (ERBB3) (NM_001005915) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ErbB 3 (ERBB3) (NM_001005915) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP21860
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.