epsilon Tubulin (TUBE1) (NM_016262) Human Recombinant Protein

Epsilon 1 Tubulin protein,

Recombinant protein of human tubulin, epsilon 1 (TUBE1)

Product Info Summary

SKU: PROTQ9UJT0
Size: 20 µg
Source: HEK293T

Product Name

epsilon Tubulin (TUBE1) (NM_016262) Human Recombinant Protein

View all Epsilon 1 Tubulin recombinant proteins

SKU/Catalog Number

PROTQ9UJT0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tubulin, epsilon 1 (TUBE1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

epsilon Tubulin (TUBE1) (NM_016262) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UJT0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

52.8 kDa

Amino Acid Sequence

MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIYDEAISSFFRNVDTRVVGDGGSISKGKICSLKARAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFRKSAEHCDCLQCFFIIHSMGGGTGSGLGTFLLKVLEDEFPEVYRFVTSIYPSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSGKLGTTVKPKSLVTSSSGALKKQHKKPFDAMNNIVANLLLNLTSSARFEGSLNMDLNEISMNLVPFPQLHYLVSSLTPLYTLTDVNIPPRRLDQMFSDAFSKDHQLLRADPKHSLYLACALMVRGNVQISDLRRNIERLKPSLQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELKERFMRLYKKKAHLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIAM

Validation Images & Assay Conditions

Gene/Protein Information For TUBE1 (Source: Uniprot.org, NCBI)

Gene Name

TUBE1

Full Name

Tubulin epsilon chain

Weight

52.8 kDa

Superfamily

tubulin family

Alternative Names

dJ142L7.2; Epsilon-tubulin; FLJ22589; FLJ44203; TUBEepsilon-tubulin; tubulin epsilon chain; tubulin, epsilon 1 TUBE1 TUBE, dJ142L7.2 tubulin epsilon 1 tubulin epsilon chain|epsilon-tubulin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TUBE1, check out the TUBE1 Infographic

TUBE1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TUBE1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UJT0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used epsilon Tubulin (TUBE1) (NM_016262) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For epsilon Tubulin (TUBE1) (NM_016262) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for epsilon Tubulin (TUBE1) (NM_016262) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UJT0
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.