CKAP1 (TBCB) (NM_001281) Human Recombinant Protein

CKAP1 protein,

Product Info Summary

SKU: PROTQ99426
Size: 20 µg
Source: HEK293T

Product Name

CKAP1 (TBCB) (NM_001281) Human Recombinant Protein

View all CKAP1 recombinant proteins

SKU/Catalog Number

PROTQ99426

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tubulin folding cofactor B (TBCB)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CKAP1 (TBCB) (NM_001281) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ99426)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.1 kDa

Amino Acid Sequence

MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI

Validation Images & Assay Conditions

Gene/Protein Information For TBCB (Source: Uniprot.org, NCBI)

Gene Name

TBCB

Full Name

Tubulin-folding cofactor B

Weight

27.1 kDa

Superfamily

TBCB family

Alternative Names

CG22Tubulin-specific chaperone B; CKAP1MGC14625; CKAPI; cytoskeleton associated protein 1; Cytoskeleton-associated protein 1Cytoskeleton-associated protein CKAPI; tubulin folding cofactor B; tubulin-folding cofactor B TBCB CG22, CKAP1, CKAPI tubulin folding cofactor B tubulin-folding cofactor B|cytoskeleton associated protein 1|cytoskeleton-associated protein CKAPI|tubulin-specific chaperone B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TBCB, check out the TBCB Infographic

TBCB infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TBCB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ99426

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CKAP1 (TBCB) (NM_001281) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CKAP1 (TBCB) (NM_001281) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CKAP1 (TBCB) (NM_001281) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ99426
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.