ELP4 (NM_019040) Human Recombinant Protein

ELP4 protein,

Product Info Summary

SKU: PROTQ96EB1
Size: 20 µg
Source: HEK293T

Product Name

ELP4 (NM_019040) Human Recombinant Protein

View all ELP4 recombinant proteins

SKU/Catalog Number

PROTQ96EB1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human elongation protein 4 homolog (S. cerevisiae) (ELP4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ELP4 (NM_019040) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96EB1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

46.4 kDa

Amino Acid Sequence

MAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTVLLIEEDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRFGHYYDASKRMPQELIEASNWHGFFLPEKISSTLKVEPCSLTPGYTKLLQFIQNIIYEEGFDGSNPQKKQRNILRIGIQNLGSPLWGDDICCAENGGNSHSLTKFLYVLRGLLRTSLSACIITMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIRQIPRLNNLICDESDVKDLAFKLKRKLFTIERLHLPPDLSDTVSRSSKMDLAESAKRLGPGCGMMAGGKKHLDF

Validation Images & Assay Conditions

Gene/Protein Information For ELP4 (Source: Uniprot.org, NCBI)

Gene Name

ELP4

Full Name

Elongator complex protein 4

Weight

46.4 kDa

Superfamily

ELP4 family

Alternative Names

C11orf19; chromosome 11 open reading frame 19; dJ68P15A.1; elongation protein 4 homolog (S. cerevisiae); elongator complex protein 4; hELP4; PAX6 neighbor gene protein; PAX6NEB; PAXNEBFLJ20498 ELP4 AN, AN2, C11orf19, PAX6NEB, PAXNEB, dJ68P15A.1, hELP4 elongator acetyltransferase complex subunit 4 elongator complex protein 4|PAX6 neighbor gene protein|elongation protein 4 homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ELP4, check out the ELP4 Infographic

ELP4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ELP4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96EB1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ELP4 (NM_019040) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ELP4 (NM_019040) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ELP4 (NM_019040) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96EB1
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.