EIF4EBP3 (NM_003732) Human Recombinant Protein

EIF4EBP3 protein,

Product Info Summary

SKU: PROTO60516
Size: 20 µg
Source: HEK293T

Product Name

EIF4EBP3 (NM_003732) Human Recombinant Protein

View all EIF4EBP3 recombinant proteins

SKU/Catalog Number

PROTO60516

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human eukaryotic translation initiation factor 4E binding protein 3 (EIF4EBP3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

EIF4EBP3 (NM_003732) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO60516)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

10.7 kDa

Amino Acid Sequence

MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI

Validation Images & Assay Conditions

Gene/Protein Information For EIF4EBP3 (Source: Uniprot.org, NCBI)

Gene Name

EIF4EBP3

Full Name

Eukaryotic translation initiation factor 4E-binding protein 3

Weight

10.7 kDa

Superfamily

eIF4E-binding protein family

Alternative Names

eIF4E-binding protein 3; eukaryotic translation initiation factor 4E binding protein 3,4E-BP3eukaryotic initiation factor 4E-binding protein 3; eukaryotic translation initiation factor 4E-binding protein 3,4EBP3 EIF4EBP3 4E-BP3, 4EBP3 eukaryotic translation initiation factor 4E binding protein 3 eukaryotic translation initiation factor 4E-binding protein 3|eIF4E-binding protein 3|eukaryotic initiation factor 4E-binding protein 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EIF4EBP3, check out the EIF4EBP3 Infographic

EIF4EBP3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EIF4EBP3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO60516

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used EIF4EBP3 (NM_003732) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For EIF4EBP3 (NM_003732) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for EIF4EBP3 (NM_003732) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO60516
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.