EEF1G (NM_001404) Human Recombinant Protein

EEF1G protein,

Product Info Summary

SKU: PROTP26641
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

EEF1G (NM_001404) Human Recombinant Protein

View all EEF1G recombinant proteins

SKU/Catalog Number

PROTP26641

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human eukaryotic translation elongation factor 1 gamma (EEF1G)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

EEF1G (NM_001404) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP26641)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

49.9 kDa

Amino Acid Sequence

MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK

Validation Images & Assay Conditions

Gene/Protein Information For EEF1G (Source: Uniprot.org, NCBI)

Gene Name

EEF1G

Full Name

Elongation factor 1-gamma

Weight

49.9 kDa

Alternative Names

eEF-1B gamma; EF-1-gamma; EF1Gelongation factor 1-gamma; eukaryotic translation elongation factor 1 gamma; GIG35; pancreatic tumor-related protein; PRO1608; translation elongation factor eEF-1 gamma chain EEF1G EF1G, GIG35 eukaryotic translation elongation factor 1 gamma elongation factor 1-gamma|EF-1-gamma|PRO1608|eEF-1B gamma|pancreatic tumor-related protein|translation elongation factor eEF-1 gamma chain

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EEF1G, check out the EEF1G Infographic

EEF1G infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EEF1G: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP26641

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used EEF1G (NM_001404) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For EEF1G (NM_001404) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for EEF1G (NM_001404) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP26641
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.