EDF1 (NM_003792) Human Recombinant Protein

EDF1 protein,

Product Info Summary

SKU: PROTO60869
Size: 20 µg
Source: HEK293T

Product Name

EDF1 (NM_003792) Human Recombinant Protein

View all EDF1 recombinant proteins

SKU/Catalog Number

PROTO60869

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

EDF1 (NM_003792) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO60869)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.2 kDa

Amino Acid Sequence

MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK

Validation Images & Assay Conditions

Gene/Protein Information For EDF1 (Source: Uniprot.org, NCBI)

Gene Name

EDF1

Full Name

Endothelial differentiation-related factor 1

Weight

16.2 kDa

Alternative Names

EDF-1Multiprotein-bridging factor 1; endothelial differentiation-related factor 1; MBF1; MGC9058; multiprotein bridging factor 1; multiprotein bridging factor-1 EDF1 CFAP280, EDF-1, MBF1 endothelial differentiation related factor 1 endothelial differentiation-related factor 1|multiprotein bridging factor 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EDF1, check out the EDF1 Infographic

EDF1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EDF1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO60869

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used EDF1 (NM_003792) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For EDF1 (NM_003792) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for EDF1 (NM_003792) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO60869
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.