DYNLL1 (NM_001037495) Human Recombinant Protein

PIN/DLC8 protein,

Product Info Summary

SKU: PROTP63167
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

DYNLL1 (NM_001037495) Human Recombinant Protein

View all PIN/DLC8 recombinant proteins

SKU/Catalog Number

PROTP63167

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DYNLL1 (NM_001037495) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP63167)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

10.2 kDa

Amino Acid Sequence

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Validation Images & Assay Conditions

Gene/Protein Information For DYNLL1 (Source: Uniprot.org, NCBI)

Gene Name

DYNLL1

Full Name

Dynein light chain 1, cytoplasmic

Weight

10.2 kDa

Superfamily

dynein light chain family

Alternative Names

cytoplasmic dynein light polypeptide; DLC1; DLC1DNCLC1; DLC8; DLC8MGC126137; DNCL1; DNCL1MGC126138; DNCLC1; dynein light chain 1, cytoplasmic; Dynein light chain LC8-type 1; dynein, cytoplasmic, light polypeptide 1; dynein, light chain, LC8-type 1,8 kDa dynein light chain; DYNLL1; hdlc1; LC8; LC8a; PIN; PINLC8a; Protein inhibitor of neuronal nitric oxide synthase DYNLL1 DLC1, DLC8, DNCL1, DNCLC1, LC8, LC8a, PIN, hdlc1 dynein light chain LC8-type 1 dynein light chain 1, cytoplasmic|8 kDa dynein light chain|cytoplasmic dynein light polypeptide|dynein, cytoplasmic, light polypeptide 1|protein inhibitor of neuronal nitric oxide synthase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DYNLL1, check out the DYNLL1 Infographic

DYNLL1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DYNLL1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP63167

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DYNLL1 (NM_001037495) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DYNLL1 (NM_001037495) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DYNLL1 (NM_001037495) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP63167
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.