DUT (NM_001025249) Human Recombinant Protein

dUTPase protein,

Product Info Summary

SKU: PROTP33316
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

DUT (NM_001025249) Human Recombinant Protein

View all dUTPase recombinant proteins

SKU/Catalog Number

PROTP33316

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DUT (NM_001025249) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP33316)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

15.2 kDa

Amino Acid Sequence

MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN

Validation Images & Assay Conditions

Gene/Protein Information For DUT (Source: Uniprot.org, NCBI)

Gene Name

DUT

Full Name

Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial

Weight

15.2 kDa

Superfamily

dUTPase family

Alternative Names

deoxyuridine triphosphatase; dUTP pyrophosphatasedUTP nucleotidohydrolase; dUTPasedeoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial; EC 3.6.1.23; FLJ20622 DUT dUTPase deoxyuridine triphosphatase deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial|dUTP diphosphatase|dUTP nucleotidohydrolase|dUTP pyrophosphatase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DUT, check out the DUT Infographic

DUT infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DUT: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP33316

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DUT (NM_001025249) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DUT (NM_001025249) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DUT (NM_001025249) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP33316
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.