DNAL1 (NM_031427) Human Recombinant Protein

DNAL1 protein,

Product Info Summary

SKU: PROTQ4LDG9
Size: 20 µg
Source: HEK293T

Product Name

DNAL1 (NM_031427) Human Recombinant Protein

View all DNAL1 recombinant proteins

SKU/Catalog Number

PROTQ4LDG9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human dynein, axonemal, light chain 1 (DNAL1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DNAL1 (NM_031427) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ4LDG9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.4 kDa

Amino Acid Sequence

MDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDN

Validation Images & Assay Conditions

Gene/Protein Information For DNAL1 (Source: Uniprot.org, NCBI)

Gene Name

DNAL1

Full Name

Dynein light chain 1, axonemal

Weight

21.4 kDa

Superfamily

dynein light chain LC1-type family

Alternative Names

C14orf168MGC12435,1700010H15RiK; chromosome 14 open reading frame 168; dynein light chain 1, axonemal; dynein, axonemal, light chain 1 DNAL1 C14orf168, CILD16, LC1 dynein axonemal light chain 1 dynein light chain 1, axonemal

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DNAL1, check out the DNAL1 Infographic

DNAL1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DNAL1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ4LDG9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DNAL1 (NM_031427) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DNAL1 (NM_031427) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DNAL1 (NM_031427) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ4LDG9
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.