DDT (NM_001084392) Human Recombinant Protein

DDT protein,

Product Info Summary

SKU: PROTP30046
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

DDT (NM_001084392) Human Recombinant Protein

View all DDT recombinant proteins

SKU/Catalog Number

PROTP30046

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human D-dopachrome tautomerase (DDT), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DDT (NM_001084392) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP30046)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12.5 kDa

Amino Acid Sequence

MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL

Validation Images & Assay Conditions

Gene/Protein Information For DDT (Source: Uniprot.org, NCBI)

Gene Name

DDT

Full Name

D-dopachrome decarboxylase

Weight

12.5 kDa

Superfamily

MIF family

Alternative Names

DDCT; D-Dopachrome Decarboxylase; D-dopachrome tautomeraseDDCT; DDT; DOPD; EC 4.1.1.84; MIF2; Phenylpyruvate Tautomerase II DDT D-DT, DDCT, MIF-2, MIF2 D-dopachrome tautomerase D-dopachrome decarboxylase|phenylpyruvate tautomerase II

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DDT, check out the DDT Infographic

DDT infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DDT: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP30046

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DDT (NM_001084392) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DDT (NM_001084392) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DDT (NM_001084392) Human Recombinant Protein

$1062
In stock, 1 left.

Order within 2 hours and 44 minutes to receive by Fri Nov 22

Get A Quote
In stock
Order Product
PROTP30046
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.